UXT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18441542	Novus Biologicals NBP2-31717-25ul	25 μL
18189573	Novus Biologicals NBP2-31717	0.1 mL

Description

UXT Polyclonal specifically detects UXT in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: UXT
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: Q9UBK9
• Gene ID (Entrez): 8409
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: DNA replication Transcription Translation and Splicing
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Androgen receptor trapped clone 27 protein, ART-27protein UXT, SKP2-associated alpha PFD 1, STAP1, Ubiquitously expressed transcript protein, ubiquitously-expressed transcript
• Gene Symbols: UXT
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only