missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. UTY Rabbit anti-Human, Polyclonal, Novus Biologicals™

UTY Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18351242 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18351242 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18351242 Supplier Novus Biologicals Supplier No. NBP311015100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

UTY Polyclonal specifically detects UTY in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen UTY
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias DKFZp686L12190, EC 1.14.11, EC 1.14.11.-, histone demethylase UTY, tetratricopeptide repeat protein, ubiquitous TPR motif protein UTY, ubiquitously transcribed tetratricopeptide repeat gene, Y chromosome, ubiquitously transcribed tetratricopeptide repeat gene, Y-linked, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 101, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 106, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 11, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 118, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 121, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 132, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 133, ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 136, ubiquitou
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human UTY (NP_009056). Peptide sequence LYETQRKYHSAKEAYEQLLQTENLPAQVKATVLQQLGWMHHNMDLVGDKA
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7404
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.