missing translation for 'onlineSavingsMsg'
Learn More

UTP11L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18386644 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18386644 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18386644 Supplier Novus Biologicals Supplier No. NBP309907100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

UTP11L Polyclonal specifically detects UTP11L in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen UTP11L
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias CGI94, CGI-94, probable U3 small nucleolar RNA-associated protein 11, U3 snoRNA-associated protein 11, UTP11-like protein, UTP11-like, U3 small nucleolar ribonucleoprotein, (yeast)
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human UTP11LL (NP_057121). Peptide sequence AKSRQREHRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEYLKALRKKA
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Cytokine Research
Primary or Secondary Primary
Gene ID (Entrez) 51118
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.