missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18338128

UT2/SLC14A2 Antibody (3E7), Novus Biologicals™

Product Code. 18338128 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18338128 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18338128 Supplier Novus Biologicals Supplier No. H00008170M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

UT2/SLC14A2 Monoclonal antibody specifically detects UT2/SLC14A2 in Human samples. It is validated for ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen UT2/SLC14A2
Applications ELISA, Sandwich ELISA
Classification Monoclonal
Clone 3E7
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_009094
Gene Alias FLJ16167, HUT2UT-A2, hUT-A6, MGC119566, solute carrier family 14 (urea transporter), member 2, Solute carrier family 14 member 2, urea transporter 2, Urea transporter, kidney, urea transporter-2, UT2MGC119567, UTA, UTR
Host Species Mouse
Immunogen SLC14A2 (NP_009094, 40 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQ
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline ABC Transporters, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 8170
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.