missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
USP9x Monoclonal antibody specifically detects USP9x in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | USP9x |
| Applications | Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | 1C4 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Alias | Deubiquitinating enzyme FAF-X, DFFRXubiquitin specific protease 9, X-linked (fat facets-like, Drosophila), Drosophila fat facets related, X-linked, EC 3.1.2.15, EC 3.4.19.12, FAF, FAM, Fat facets in mammals, fat facets protein related, X-linked, Fat facets protein-related, X-linked, hFAM, probable ubiquitin carboxyl-terminal hydrolase FAF-X, ubiquitin specific peptidase 9, X-linked, ubiquitin specific peptidase 9, X-linked (fat facets-like, Drosophila), ubiquitin thioesterase FAF-X, Ubiquitin thiolesterase FAF-X, ubiquitin-specific processing protease FAF-X, Ubiquitin-specific protease 9, X chromosome, Ubiquitin-specific-processing protease FAF-X, USP9, X chromosome (fat facets-like Drosophila) |
| Host Species | Mouse |
| Immunogen | USP9X (NP_068706, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLP |
| Purification Method | IgG purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?