missing translation for 'onlineSavingsMsg'
Learn More

USP6 Antibody (1F5), Novus Biologicals™

Product Code. 18377948 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18377948 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18377948 Supplier Novus Biologicals Supplier No. H00009098M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

USP6 Monoclonal antibody specifically detects USP6 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen USP6
Applications Western Blot, ELISA
Classification Monoclonal
Clone 1F5
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_004496
Gene Alias Deubiquitinating enzyme 6, EC 3.1.2.15, EC 3.4.19.12, HRP1, hyperpolymorphic gene 1, Proto-oncogene TRE-2, TRE17, Tre2, Tre-2, tre-2 oncogene, TRE2USP6-short, ubiquitin carboxyl-terminal hydrolase 6, ubiquitin specific peptidase 6-, ubiquitin specific peptidase 6 (Tre-2 oncogene), ubiquitin specific protease 6 (Tre-2 oncogene), ubiquitin thioesterase 6, Ubiquitin thiolesterase 6, ubiquitin-specific protease USP6, Ubiquitin-specific-processing protease 6
Host Species Mouse
Immunogen USP6 (NP_004496, 2 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DMVENADSLQAQERKDILMKYDKGHRAGLPEDKGPEPVGINSSIDRFGILHETELPPVTAREAKKIRREMTRTSKWMEMLGEWETYKH
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cell Biology
Primary or Secondary Primary
Gene ID (Entrez) 9098
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.