USP6 Antibody (1F5), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00009098-M01

Product Code. 18377948

Description

USP6 Monoclonal antibody specifically detects USP6 in Human samples. It is validated for Western Blot, ELISA

Specifications

• Antigen: USP6
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: Deubiquitinating enzyme 6, EC 3.1.2.15, EC 3.4.19.12, HRP1, hyperpolymorphic gene 1, Proto-oncogene TRE-2, TRE17, Tre2, Tre-2, tre-2 oncogene, TRE2USP6-short, ubiquitin carboxyl-terminal hydrolase 6, ubiquitin specific peptidase 6-, ubiquitin specific peptidase 6 (Tre-2 oncogene), ubiquitin specific protease 6 (Tre-2 oncogene), ubiquitin thioesterase 6, Ubiquitin thiolesterase 6, ubiquitin-specific protease USP6, Ubiquitin-specific-processing protease 6
• Immunogen: USP6 (NP_004496, 2 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DMVENADSLQAQERKDILMKYDKGHRAGLPEDKGPEPVGINSSIDRFGILHETELPPVTAREAKKIRREMTRTSKWMEMLGEWETYKH
• Quantity: 0.1 mg
• Research Discipline: Cell Biology
• Gene ID (Entrez): 9098
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ

• Applications: Western Blot, ELISA
• Clone: 1F5
• Dilution: Western Blot 1:500, ELISA
• Gene Accession No.: NP_004496
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified