missing translation for 'onlineSavingsMsg'
Learn More
Learn More
USP46 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35794-20ul
This item is not returnable.
View return policy
Description
USP46 Polyclonal antibody specifically detects USP46 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| USP46 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:100 | |
| Deubiquitinating enzyme 46, EC 3.1.2.15, EC 3.4.19.12, FLJ11850, FLJ12552, FLJ14283, FLJ39393, ubiquitin carboxyl-terminal hydrolase 46, ubiquitin specific peptidase 46, ubiquitin specific protease 46, ubiquitin thioesterase 46, Ubiquitin thiolesterase 46, Ubiquitin-specific-processing protease 46 | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human USP46 (NP_073743.2).,, Sequence:, KKFISRLRKENDLFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSV | |
| 20 μL | |
| DNA replication Transcription Translation and Splicing | |
| 64854 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction