missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
USP39 Polyclonal antibody specifically detects USP39 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | USP39 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | CGI-21, HSPC332, Inactive ubiquitin-specific peptidase 39,65K, SAD1 homolog, SAD1MGC75069, small nuclear ribonucleoprotein 65kDa (U4/U6.U5), SnRNP assembly defective 1 homolog, SNRNP65, U4/U6.U5 tri-snRNP-associated 65 kDa protein, U4/U6.U5 tri-snRNP-associated protein 2, ubiquitin specific peptidase 39, ubiquitin specific protease 39 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETN |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?