missing translation for 'onlineSavingsMsg'
Learn More
Learn More
USP29 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Spécification
| Antigen | USP29 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
USP29 Polyclonal specifically detects USP29 in Human samples. It is validated for Western Blot.Spécification
| USP29 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Deubiquitinating enzyme 29, EC 3.1.2.15, EC 3.4.19.12, HOM-TES-84/86, MGC163266, MGC163270, ubiquitin carboxyl-terminal hydrolase 29, ubiquitin specific peptidase 29, ubiquitin specific protease 29, ubiquitin thioesterase 29, Ubiquitin thiolesterase 29, ubiquitin-specific processing protease, Ubiquitin-specific-processing protease 29 | |
| USP29 | |
| IgG | |
| 104 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_065954 | |
| 57663 | |
| Synthetic peptide directed towards the N terminal of human USP29The immunogen for this antibody is USP29. Peptide sequence EDILKEDNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNT. | |
| Primary |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit