USP29 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-94672-0.1ml

Product Code. 18603601

Description

USP29 Polyclonal antibody specifically detects USP29 in Human samples. It is validated for Western Blot

Specifications

• Antigen: USP29
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:1000
• Gene Alias: Deubiquitinating enzyme 29, EC 3.1.2.15, EC 3.4.19.12, HOM-TES-84/86, MGC163266, MGC163270, ubiquitin carboxyl-terminal hydrolase 29, ubiquitin specific peptidase 29, ubiquitin specific protease 29, ubiquitin thioesterase 29, Ubiquitin thiolesterase 29, ubiquitin-specific processing protease, Ubiquitin-specific-processing protease 29
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human usp29 (NP_065954.1). LKYIQSNRKNPSSLEDLEKDRDLKLGPSFNTNCNGNPNLDETVLATQTLNAKNGLTSPLEPEHSQGDPRCNKAQVPLDSHSQQLQQGFPNLGNTCYMNAVL
• Quantity: 0.1 mL
• Research Discipline: Cell Biology
• Gene ID (Entrez): 57663
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified