USP13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35117-100ul

Product Code. 30230074

Description

USP13 Polyclonal antibody specifically detects USP13 in Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: USP13
• Classification: Polyclonal
• Dilution: Western Blot 1:1000 - 1:2000, ELISA
• Gene Alias: Deubiquitinating enzyme 13, EC 3.1.2.15, EC 3.4.19.12, Isopeptidase T-3, ISOT-3, ISOT3IsoT-3, ubiquitin carboxyl-terminal hydrolase 13, ubiquitin specific peptidase 13 (isopeptidase T-3), ubiquitin specific protease 13 (isopeptidase T-3), ubiquitin thioesterase 13, Ubiquitin thiolesterase 13, Ubiquitin-specific-processing protease 13
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 90-200 of human USP13 (NP_003931.2).,, Sequence:, MHLKRHVREKVRGASGGALPKRRNSKIFLDLDTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDN
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Mouse, Rat
• Form: Purified

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8975
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG