missing translation for 'onlineSavingsMsg'
Learn More
Learn More
USH1C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-89190
This item is not returnable.
View return policy
Description
USH1C Polyclonal specifically detects USH1C in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| USH1C | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| AIE75, AIE-75, Antigen NY-CO-38/NY-CO-37, Autoimmune enteropathy-related antigen AIE-75, deafness, autosomal recessive 18, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-45, PDZ73, PDZ-73, PDZ-73/NY-CO-38, Protein PDZ-73, Renal carcinoma antigen NY-REN-3, ush1cpst, Usher syndrome 1C (autosomal recessive, severe), Usher syndrome type-1C protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human USH1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| USH1C | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRKYEEGFDPYSM | |
| 0.1 mL | |
| Signal Transduction, Vision | |
| 10083 | |
| Human, Mouse | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction