USF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55392-25ul

Artikelnummer. 18696226

Beskrivelse

USF1 Polyclonal specifically detects USF1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Tekniske data

• Antigen: USF1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: BHLHB11, bHLHb11FCHL1, Class B basic helix-loop-helix protein 11, FCHL, HYPLIP1, Major late transcription factor 1, MLTF, MLTFI, UEF, upstream stimulatory factor 1, upstream transcription factor 1, USF
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: USF1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDT
• Quantity: 25 μL
• Research Discipline: Transcription Factors and Regulators
• Gene ID (Entrez): 7391
• Target Species: Human
• Isotype: IgG

For Research Use Only