missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
USAG1/SOSTDC1 Polyclonal antibody specifically detects USAG1/SOSTDC1 in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | USAG1/SOSTDC1 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | cystine-knot containing secreted protein, DKFZp564D206, Ectodermal BMP inhibitor, ECTODIN, sclerostin domain containing 1, sclerostin domain-containing protein 1, USAG-1, USAG1uterine sensitization-associated protein-1, Uterine sensitization-associated gene 1 protein |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?