missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Uroguanylin Polyclonal specifically detects Uroguanylin in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | Uroguanylin |
| Applications | Western Blot |
| Classification | Polyclonal |
| Concentration | 0.5 mg/ml |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS, 2% Sucrose |
| Gene Alias | GCAP-II, guanylate cyclase activator 2B, guanylate cyclase activator 2B (uroguanylin), UGN, uroguanylin |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human Uroguanylin. Peptide sequence: MKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFK The peptide sequence for this immunogen was taken from within the described region. |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?