missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UROD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-56662
This item is not returnable.
View return policy
Description
UROD Polyclonal specifically detects UROD in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| UROD | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| EC 4.1.1.37, PCT, UPD, URO-D, uroporphyrinogen decarboxylase, uroporphyrinogen III decarboxylase | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Pig: 100%; Rat: 100%; Guinea pig: 92%; Rabbit: 92%; Chicken: 83%; Zebrafish: 83%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Yeast, Zebrafish | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| P06132 | |
| UROD | |
| Synthetic peptides corresponding to UROD(uroporphyrinogen decarboxylase) The peptide sequence was selected from the N terminal of UROD. Peptide sequence VPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVP The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μL | |
| Lipid and Metabolism | |
| 7389 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction