missing translation for 'onlineSavingsMsg'
Learn More

URI Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

£328.00 - £513.00

Specifications

Antigen	URI
Applications	Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18234782 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-57701	100 μL	£513.00 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18650679 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-57701-25ul	25 μL	£328.00 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

URI Polyclonal specifically detects URI in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	URI
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene ID (Entrez)	8725
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGK
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	chromosome 19 open reading frame 2, FLJ10575, NNX3RPB5-mediating protein, Protein NNX3, RMPunconventional prefoldin RPB5 interactor, RNA polymerase II subunit 5-mediating protein, URIRNA polymerase II, subunit 5-mediating protein
Gene Symbols	URI1
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

URI Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents