missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. UQCRFS1 Antibody, Novus Biologicals™

UQCRFS1 Antibody, Novus Biologicals™

Product Code. 18428081 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Tamaño de la unidad:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity unitSize
18428081 25 μL 25µL
18220197 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18428081 Proveedor Novus Biologicals missing translation for 'supplierNo' NBP18782625ul

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody has been used in 2 publications

UQCRFS1 Polyclonal specifically detects UQCRFS1 in Human, Rat samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen UQCRFS1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Simple Western 1:30, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50-1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias Complex III subunit 5, Cytochrome b-c1 complex subunit 5, cytochrome b-c1 complex subunit Rieske, mitochondrial, EC 1.10.2.2, Rieske iron-sulfur protein, RIP1, RIS1, RISPUbiquinol-cytochrome c reductase iron-sulfur subunit, ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1, UQCR5
Gene Symbols UQCRFS1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Breast Cancer
Primary or Secondary Primary
Gene ID (Entrez) 7386
Test Specificity Specificity of human UQCRFS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.