missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UQCR10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-62349
This item is not returnable.
View return policy
Description
UQCR10 Polyclonal specifically detects UQCR10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| UQCR10 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Complex III subunit 9, Complex III subunit X, cytochrome b-c1 complex subunit 9, Cytochrome c1 non-heme 7 kDa protein, cytochrome C1, nonheme 7kDa protein, HSPC051, HSPC151, QCR9, ubiquinol-cytochrome c reductase complex (7.2 kD), ubiquinol-cytochrome c reductase, complex III subunit X, ubiquinol-cytochrome c reductase, complex III subunit X, 7.2kDa, UCCR7.2, UCRCUbiquinol-cytochrome c reductase complex 7.2 kDa protein | |
| Rabbit | |
| 7 kDa | |
| 100 μL | |
| Primary | |
| This product is specific to Subunit or Isoform: 9. | |
| Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
| Q9UDW1 | |
| UQCR10 | |
| Synthetic peptides corresponding to UCRC(ubiquinol-cytochrome c reductase complex (7.2 kD)) The peptide sequence was selected from the middle region of UCRC. Peptide sequence LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK. | |
| Affinity purified | |
| RUO | |
| 29796 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction