missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18352379

UQCR10 Antibody (2B5), Novus Biologicals™

Product Code. 18352379 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18352379 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18352379 Supplier Novus Biologicals Supplier No. H00029796M07

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

UQCR10 Monoclonal antibody specifically detects UQCR10 in Human samples. It is validated for ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen UQCR10
Applications ELISA, Sandwich ELISA
Classification Monoclonal
Clone 2B5
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH05402
Gene Alias Complex III subunit 9, Complex III subunit X, cytochrome b-c1 complex subunit 9, Cytochrome c1 non-heme 7 kDa protein, cytochrome C1, nonheme 7kDa protein, HSPC051, HSPC151, QCR9, ubiquinol-cytochrome c reductase complex (7.2 kD), ubiquinol-cytochrome c reductase, complex III subunit X, ubiquinol-cytochrome c reductase, complex III subunit X, 7.2kDa, UCCR7.2, UCRCUbiquinol-cytochrome c reductase complex 7.2 kDa protein
Host Species Mouse
Immunogen UCRC (AAH05402, 1 a.a. ~ 63 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 29796
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.