missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UPF3A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | UPF3A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
UPF3A Polyclonal specifically detects UPF3A in Human samples. It is validated for Western Blot.Specifications
| UPF3A | |
| Polyclonal | |
| Rabbit | |
| Human | |
| HUPF3A, Nonsense mRNA reducing factor 3A, regulator of nonsense transcripts 3A, RENT3AUp-frameshift suppressor 3 homolog A, UPF3 regulator of nonsense transcripts homolog A (yeast), UPF3hUpf3 | |
| UPF3A | |
| IgG | |
| 55 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9H1J1 | |
| 65110 | |
| Synthetic peptides corresponding to UPF3A(UPF3 regulator of nonsense transcripts homolog A (yeast)) The peptide sequence was selected from the middle region of UPF3A (NP_075387). Peptide sequence QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title