missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UNG, Mouse anti-Human, Polyclonal Antibody, Abnova™
Description
Sequence: MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
Specifications
Specifications
| Antigen | UNG |
| Applications | Immunofluorescence, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene | uracil-DNA glycosylase |
| Gene Accession No. | NM_003362 |
| Gene Alias | DGU/DKFZp781L1143/HIGM4/UDG/UNG1/UNG15/UNG2 |
| Gene Symbols | UNG |
| Host Species | Mouse |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?