missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18379438

UNC119 Antibody, Novus Biologicals™

Product Code. 18379438 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
50 μg
Unit Size:
50µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18379438 50 μg 50µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18379438 Supplier Novus Biologicals Supplier No. H00009094B01P50ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

UNC119 Polyclonal antibody specifically detects UNC119 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
TRUSTED_SUSTAINABILITY

Specifications

Antigen UNC119
Applications Western Blot, Immunocytochemistry, Immunoprecipitation
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100 to 1:2000, Immunocytochemistry/ Immunofluorescence 1:10 to 1:500, Immunoprecipitation 1:10 to 1:500
Formulation PBS (pH 7.4)
Gene Accession No. NP_005139.1
Gene Alias hRG4, HRG4POC7 centriolar protein homolog A, POC7, POC7A, protein unc-119 homolog A, Retinal protein 4, RG4, unc119 (C.elegans) homolog, unc-119 homolog (C. elegans)
Host Species Mouse
Immunogen UNC119 (NP_005139.1, 1 a.a. - 240 a.a.) full-length human protein. MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Purification Method Immunogen affinity purified
Quantity 50 μg
Regulatory Status RUO
Research Discipline Vision
Primary or Secondary Primary
Gene ID (Entrez) 9094
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.