missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18415019

ULBP-2 Antibody, Novus Biologicals™

Product Code. 18415019 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
50µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18415019 0.05 mg 50µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18415019 Supplier Novus Biologicals Supplier No. H00080328B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

ULBP-2 Polyclonal antibody specifically detects ULBP-2 in Human samples. It is validated for Western Blot, Flow Cytometry, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen ULBP-2
Applications Western Blot, Flow Cytometry, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500, Flow Cytometry, Immunocytochemistry/ Immunofluorescence
Formulation PBS (pH 7.4)
Gene Accession No. AAH34689
Gene Alias ALCAN-alpha, N2DL2, N2DL-2, NKG2D ligand 2, RAET1HNKG2DL2, retinoic acid early transcript 1 H, Retinoic acid early transcript 1H, UL16 binding protein 2, UL16-binding protein 2
Host Species Mouse
Immunogen ULBP2 (AAH34689, 1 a.a. - 246 a.a.) full-length human protein. MEAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI
Purification Method IgG purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Immunology, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 80328
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.