Invitrogen™ UHRF2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA580206

Product Code. 15995765

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat testis tissue, K562 whole cell. IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue.

This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.

Specifications

• Antigen: UHRF2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: UHRF2
• Gene Alias: 2310065A22Rik; AI426270; AW214556; D130071B19Rik; E3 ubiquitin-protein ligase UHRF2; Nirf; np95/ICBP90-like RING finger protein; Np95-like ring finger protein; Nuclear protein 97; nuclear zinc finger protein Np97; RING finger protein 107; RING-type E3 ubiquitin transferase UHRF2; RNF107; RP11-472F14.2; TDRD23; ubiquitin like with PHD and ring finger domains 2; ubiquitin-like PHD and RING finger domain-containing protein 2; ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase; ubiquitin-like, containing PHD and RING finger domains 2; ubiquitin-like, containing PHD and RING finger domains, 2; ubiquitin-like-containing PHD and RING finger domains protein 2; UHRF2; URF2
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 109113, 115426, 309331
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q7TMI3, Q96PU4
• Gene Symbols: UHRF2
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15-54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG