missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. UHRF1 Antibody, Novus Biologicals™

UHRF1 Antibody, Novus Biologicals™

Product Code. 18400442 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18400442 25 μL 25µL
18469671 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18400442 Supplier Novus Biologicals Supplier No. NBP21350425ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

UHRF1 Polyclonal antibody specifically detects UHRF1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen UHRF1
Applications Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias E3 ubiquitin-protein ligase UHRF1, EC 6.3.2, EC 6.3.2.-, FLJ21925, hNP95, huNp95, ICBP90NP95, Inverted CCAAT box-binding protein of 90 kDa, Np95, Nuclear protein 95, Nuclear zinc finger protein Np95, RING finger protein 106, RNF106MGC138707, Transcription factor ICBP90, Ubiquitin-like PHD and RING finger domain-containing protein 1, ubiquitin-like with PHD and ring finger domains 1, ubiquitin-like, containing PHD and RING finger domains, 1, Ubiquitin-like-containing PHD and RING finger domains protein 1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: VFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDE
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline DNA Repair, Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 29128
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.