missing translation for 'onlineSavingsMsg'
Learn More

UGT2B7 Antibody (8D12), Novus Biologicals™

Product Code. 18399577 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18399577 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18399577 Supplier Novus Biologicals Supplier No. H00007364M02100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

UGT2B7 Monoclonal antibody specifically detects UGT2B7 in Human, Rat samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen UGT2B7
Applications Western Blot, ELISA
Classification Monoclonal
Clone 8D12
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_001065
Gene Alias UDP glucuronosyltransferase 2 family, polypeptide B73,4-catechol estrogen specific, UDP glycosyltransferase 2 family, polypeptide B7, UGT2B9family 2, beta-7, UGTB2B9
Host Species Mouse
Immunogen UGT2B7 (NP_001065, 69 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCS
Purification Method Protein A or G purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 7364
Target Species Human, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.