missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UGT2B7 Antibody (8D12), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00007364-M02-100ug
This item is not returnable.
View return policy
Description
UGT2B7 Monoclonal antibody specifically detects UGT2B7 in Human, Rat samples. It is validated for Western Blot, ELISA
Specifications
| UGT2B7 | |
| Monoclonal | |
| Unconjugated | |
| NP_001065 | |
| Mouse | |
| Protein A or G purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
| Western Blot, ELISA | |
| 8D12 | |
| In 1x PBS, pH 7.4 | |
| UDP glucuronosyltransferase 2 family, polypeptide B73,4-catechol estrogen specific, UDP glycosyltransferase 2 family, polypeptide B7, UGT2B9family 2, beta-7, UGTB2B9 | |
| UGT2B7 (NP_001065, 69 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCS | |
| 100 μg | |
| Cancer, Cell Biology, Endocrinology, Signal Transduction | |
| 7364 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2b κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction