missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
UGT2B10 Monoclonal antibody specifically detects UGT2B10 in Human samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | UGT2B10 |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Clone | 1B5 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_001066 |
| Gene Alias | EC 2.4.1.17, MGC142209, UDP glucuronosyltransferase 2 family, polypeptide B10, UDP glucuronosyltransferase 2B10, UDP glycosyltransferase 2 family, polypeptide B10, UDP-glucuronosyltransferase 2B10, UDPGT 2B10, UDPGT2B10 |
| Host Species | Mouse |
| Immunogen | UGT2B10 (NP_001066, 62 a.a. ∽ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LFDPNDSSTLKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQESRFDIVFADAYLPCGELL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?