UGT1A9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69689

Product Code. 18248724

Description

UGT1A9 Polyclonal specifically detects UGT1A9 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UGT1A9
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.4.1.17, GNT1, HLUGP4, LUGP4, polypeptide A9, UDP glucuronosyltransferase 1 family, polypeptide A9, UDP-glucuronosyltransferase 1-9, UDP-glucuronosyltransferase 1A9, UDP-glucuronosyltransferase 1-I, UDPGT, UDPGT 1-9, UGT1, UGT1*9, UGT1.9, UGT1-09, UGT1-9, UGT1AI, UGT1I, UGT-1I
• Host Species: Rabbit
• Molecular Weight of Antigen: 57 kDa
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 54600
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O60656
• Gene Symbols: UGT1A9
• Immunogen: Synthetic peptides corresponding to UGT1A9(UDP glucuronosyltransferase 1 family, polypeptide A9) The peptide sequence was selected from the N terminal of UGT1A9. Peptide sequence LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Sheep: 83%.
• Target Species: Human, Mouse, Rat, Rabbit, Sheep
• Isotype: IgG

For Research Use Only