missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UGGT1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93283-0.1ml
This item is not returnable.
View return policy
Description
UGGT1 Polyclonal antibody specifically detects UGGT1 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| UGGT1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| FLJ21763, GT, HUGT1, UDP--Glc:glycoprotein glucosyltransferase, UDP-glucose ceramide glucosyltransferase-like 1, UDP-glucose glycoprotein glucosyltransferase 1, UGCGL1, UGGT, UGT1, UGTR | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1456-1555 of human UGGT1 (NP_064505.1). PNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKEPKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREEL | |
| 0.1 mL | |
| Signal Transduction | |
| 56886 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction