missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UFSP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | UFSP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
UFSP2 Polyclonal specifically detects UFSP2 in Human samples. It is validated for Western Blot.Specifications
| UFSP2 | |
| Polyclonal | |
| Rabbit | |
| FLJ11200, UFM1-specific peptidase 2, ufm1-specific protease 2 | |
| UFSP2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 55325 | |
| Synthetic peptides corresponding to C4ORF20 The peptide sequence was selected from the middle region of C4ORF20. Peptide sequence YHHYMQDRIDDNGWGCAYRSLQTICSWFKHQGYTERSIPTHREIQQALVD. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title