missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UFSP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£342.00 - £513.00
Specifications
| Antigen | UFSP2 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|
18444061
|
Novus Biologicals
NBP1-86781-25ul |
25 μL |
£342.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18253686
|
Novus Biologicals
NBP1-86781 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
UFSP2 Polyclonal specifically detects UFSP2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifikationer
| UFSP2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ11200, UFM1-specific peptidase 2, ufm1-specific protease 2 | |
| UFSP2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 55325 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LAFQLATPNEIFLKKALKHVLSDLSTKLSSNALVFRICHSSVYIWPSSDINTIPGELTDASACKNILRFIQFEPEED | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel