UFD1L Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33259-100ul

Product Code. 30228764

Description

UFD1L Monoclonal antibody specifically detects UFD1L in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: UFD1L
• Classification: Monoclonal
• Dilution: Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: ATP1C, ATP1G1ATPase, Na+/K+ transporting, gamma 1 polypeptide, FXYD domain containing ion transport regulator 2, FXYD domain-containing ion transport regulator 2, HOMG2, hypomagnesemia 2, renal, MGC12372, Na(+)/K(+) ATPase subunit gamma, Sodium pump gamma chain, sodium/potassium-transporting ATPase subunit gamma, Sodium-potassium-ATPase, gamma polypeptide
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UFD1L (Q92890).,, Sequence:, MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQ
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7353
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG