missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UEVLD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | UEVLD |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
UEVLD Polyclonal specifically detects UEVLD in Human samples. It is validated for Western Blot.Specifications
| UEVLD | |
| Polyclonal | |
| Rabbit | |
| A8MYV4 | |
| 55293 | |
| Synthetic peptides corresponding to UEVLD(UEV and lactate/malate dehyrogenase domains) The peptide sequence was selected from the N terminal of UEVLD. Peptide sequence FKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Attp, EV and lactate/malate dehydrogenase domain-containing protein, signaling molecule ATTP, ubiquitin-conjugating enzyme E2 variant 3, UEV and lactate/malate dehyrogenase domains, UEV-3, UEV3FLJ11068 | |
| UEVLD | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title