UCP3 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33419-100ul

Product Code. 30229797

Beschreibung

UCP3 Monoclonal antibody specifically detects UCP3 in Mouse samples. It is validated for ELISA,Western Blot

Spezifikation

• Antigen: UCP3
• Classification: Monoclonal
• Dilution: Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: mitochondrial uncoupling protein 3, SLC25A9Solute carrier family 25 member 9, UCP 3, uncoupling protein 3 (mitochondrial, proton carrier), Uncoupling protein-3
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human UCP3 (NP_003347.1).,, Sequence:, YDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRA
• Quantity: 100 μL
• Research Discipline: Cancer, Cardiovascular Biology, Diabetes Research, Endocrinology, metabolism, Neuroscience, Signal Transduction
• Gene ID (Entrez): 7352
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified