missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UCP3 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33419-20ul
This item is not returnable.
View return policy
Description
UCP3 Monoclonal antibody specifically detects UCP3 in Mouse samples. It is validated for ELISA,Western Blot
Specifications
| UCP3 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| mitochondrial uncoupling protein 3, SLC25A9Solute carrier family 25 member 9, UCP 3, uncoupling protein 3 (mitochondrial, proton carrier), Uncoupling protein-3 | |
| A synthetic peptide corresponding to a sequence within amino acids 200-300 of human UCP3 (NP_003347.1).,, Sequence:, YDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRA | |
| 20 μL | |
| Cancer, Cardiovascular Biology, Diabetes Research, Endocrinology, metabolism, Neuroscience, Signal Transduction | |
| 7352 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction