UCH-L5/UCH37 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18459901	Novus Biologicals NBP1-85656-25ul	25 μL
18257906	Novus Biologicals NBP1-85656	0.1 mL

Description

UCH-L5/UCH37 Polyclonal specifically detects UCH-L5/UCH37 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: UCH-L5/UCH37
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 51377
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:CTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKT
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:200-1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: EC 3.4.19.12, INO80 complex subunit R, INO80R, ubiquitin carboxyl-terminal esterase L5, ubiquitin carboxyl-terminal hydrolase isozyme L5, ubiquitin carboxyl-terminal hydrolase L5, Ubiquitin C-terminal hydrolase UCH37, Ubiquitin thioesterase L5, UCH37CGI-70, UCH-L5
• Gene Symbols: UCHL5
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only