missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBXN1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17958-100UL
This item is not returnable.
View return policy
Description
UBXN1 Polyclonal antibody specifically detects UBXN1 in Human samples. It is validated for Western Blot, Immunofluorescence
Specifications
| UBXN1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| 2B28, LOC51035, SAKS1UBA/UBX 33.3 kDa protein, SAPK substrate protein 1, UBX domain protein 1, UBX domain-containing protein 1, UBXD10 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDG | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 51035 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction