missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBXN1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | UBXN1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
UBXN1 Polyclonal specifically detects UBXN1 in Human samples. It is validated for Western Blot.Specifications
| UBXN1 | |
| Polyclonal | |
| Rabbit | |
| Q04323-2 | |
| 51035 | |
| Synthetic peptides corresponding to LOC51035(SAPK substrate protein 1) The peptide sequence was selected from the middle region of LOC51035. Peptide sequence RIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 2B28, LOC51035, SAKS1UBA/UBX 33.3 kDa protein, SAPK substrate protein 1, UBX domain protein 1, UBX domain-containing protein 1, UBXD10 | |
| UBXN1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title