UBXD5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18492871	Novus Biologicals NBP1-87018-25ul	25 μL
18296186	Novus Biologicals NBP1-87018	0.1 mL

Description

UBXD5 Polyclonal specifically detects UBXD5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: UBXD5
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 91544
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SENGEQAFLLMMQPDNTIGDVRALLAQARVMDASAFEIFSTFPPTLYQDDTLTLQAAGLVPKAALLLRARRAPKSSLKFSPGP
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: COA-1, Colorectal tumor-associated antigen COA-1, colorectal tumor-associated antigen-1, SOCDKFZp686F04228, SOCI, socius, UBX domain containing 5, UBX domain protein 11, UBX domain-containing protein 11, UBX domain-containing protein 5, UBXD5
• Gene Symbols: UBXN11
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only