missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBTD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | UBTD2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
UBTD2 Polyclonal specifically detects UBTD2 in Human samples. It is validated for Western Blot.Specifications
| UBTD2 | |
| Polyclonal | |
| Rabbit | |
| NP_689490 | |
| 92181 | |
| Synthetic peptide directed towards the C terminal of human UBTD2The immunogen for this antibody is UBTD2. Peptide sequence TDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DC-UbP, DCUBPDendritic cell-derived ubiquitin-like protein, MGC30022ubiquitin domain-containing protein 2, ubiquitin domain containing 2, Ubiquitin-like protein SB72 | |
| UBTD2 | |
| IgG | |
| 26 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title