missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBQLN3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | UBQLN3 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
UBQLN3 Polyclonal specifically detects UBQLN3 in Human samples. It is validated for Western Blot, PCR.Specifications
| UBQLN3 | |
| Unconjugated | |
| RUO | |
| TUP-1, ubiquilin 3, ubiquilin-3 | |
| UBQLN3 | |
| IgG | |
| 72 kDa |
| Polyclonal | |
| Rabbit | |
| Q9H347 | |
| 50613 | |
| Synthetic peptides corresponding to UBQLN3(ubiquilin 3) The peptide sequence was selected from the N terminal of UBQLN3. Peptide sequence LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title