missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBL7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | UBL7 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18248614
|
Novus Biologicals
NBP2-58983 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18697976
|
Novus Biologicals
NBP2-58983-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
UBL7 Polyclonal specifically detects UBL7 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| UBL7 | |
| Polyclonal | |
| Rabbit | |
| BMSCUBP, BMSC-UbPTCBA1, Bone marrow stromal cell ubiquitin-like protein, MGC14421, ubiquitin-like 7 (bone marrow stromal cell-derived), ubiquitin-like protein 7, Ubiquitin-like protein SB132 | |
| UBL7 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| 84993 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGTSPMSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIQDDELS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title