UBL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-38069-20ul

Product Code. 30233053

Description

UBL3 Polyclonal antibody specifically detects UBL3 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)

Specifications

• Antigen: UBL3
• Classification: Polyclonal
• Dilution: Western Blot 1:1000 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: DKFZP434K151, FLJ32018, HCG-1, hsMUB, Membrane-anchored ubiquitin-fold protein, MUB, PNSC1, Protein HCG-1, ubiquitin-like 3, ubiquitin-like protein 3
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human UBL3 (NP_009037.1).,, Sequence:, MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5412
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG