missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBL3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38069-20ul
This item is not returnable.
View return policy
Description
UBL3 Polyclonal antibody specifically detects UBL3 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
| UBL3 | |
| Polyclonal | |
| Western Blot 1:1000 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| DKFZP434K151, FLJ32018, HCG-1, hsMUB, Membrane-anchored ubiquitin-fold protein, MUB, PNSC1, Protein HCG-1, ubiquitin-like 3, ubiquitin-like protein 3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human UBL3 (NP_009037.1).,, Sequence:, MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 5412 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction