missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18319739

Ubiquilin 2 Antibody (5F5), Novus Biologicals™

Product Code. 18319739 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18319739 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18319739 Supplier Novus Biologicals Supplier No. H00029978M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Ubiquilin 2 Monoclonal antibody specifically detects Ubiquilin 2 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen), KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen Ubiquilin 2
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen), KnockDown
Classification Monoclonal
Clone 5F5
Conjugate Unconjugated
Dilution Western Blot, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500, Knockdown Validated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_038472
Gene Alias Chap1, CHAP1/DSK2, DSK2, DSK2 homolog, FLJ10167, FLJ56541, hPLIC-2, N4BP4LIC-2, Nedd4 binding protein 4, PLIC-2, PLIC2Dsk2, Protein linking IAP with cytoskeleton 2, RIHFB2157, ubiquilin 2, ubiquilin-2, Ubiquitin-like product Chap1/Dsk2
Host Species Mouse
Immunogen UBQLN2 (NP_038472, 555 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cell Biology
Primary or Secondary Primary
Gene ID (Entrez) 29978
Target Species Human, Mouse, Rat
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.