missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBE2S Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38822-25ul
This item is not returnable.
View return policy
Description
UBE2S Polyclonal specifically detects UBE2S in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| UBE2S | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q16763 | |
| UBE2S | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPN | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| E2-EPF5, E2-EPFEC 6.3.2.19, E2EPFEPF5, Ubiquitin carrier protein S, ubiquitin-conjugating enzyme E2 S, ubiquitin-conjugating enzyme E2-24 kD, Ubiquitin-conjugating enzyme E2-24 kDa, Ubiquitin-conjugating enzyme E2-EPF5, ubiquitin-conjugating enzyme E2S, Ubiquitin-protein ligase S | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 27338 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction