missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBE2R1/CDC34 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38156-20ul
This item is not returnable.
View return policy
Description
UBE2R1/CDC34 Polyclonal antibody specifically detects UBE2R1/CDC34 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| UBE2R1/CDC34 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| cell division cycle 34, cell division cycle 34 homolog (S. cerevisiae), E2-CDC34, EC 6.3.2.19, UBC3, UBE2R1UBCH3, ubiquitin carrier protein, ubiquitin-conjugating enzyme E2 R1, Ubiquitin-conjugating enzyme E2-32 kDa complementing, Ubiquitin-conjugating enzyme E2-CDC34, Ubiquitin-protein ligase R1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 150-236 of human UBE2R1/CDC34 (NP_004350.1).,, Sequence:, KWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES | |
| 20 μL | |
| Cancer, Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| 997 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction