missing translation for 'onlineSavingsMsg'
Learn More

UBE2G2 Antibody (5E1), Novus Biologicals™

Product Code. 18342238 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18342238 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18342238 Supplier Novus Biologicals Supplier No. H00007327M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

UBE2G2 Monoclonal antibody specifically detects UBE2G2 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen UBE2G2
Applications Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Sandwich ELISA
Classification Monoclonal
Clone 5E1
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_003334.2
Gene Alias EC 6.3.2.19, UBC7human ubiquitin conjugating enzyme G210ubiquitin-conjugating enzyme E2G 2 (homologous to yeast UBC7), Ubiquitin carrier protein G2, ubiquitin conjugating enzyme 7, ubiquitin conjugating enzyme G2, ubiquitin-conjugating enzyme E2 G2, ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast), Ubiquitin-protein ligase G2
Host Species Mouse
Immunogen UBE2G2 (NP_003329, 1 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGR
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 7327
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.