missing translation for 'onlineSavingsMsg'
Learn More

UBE2E3 Antibody (4C4), Novus Biologicals™

Product Code. 18326988 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18326988 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18326988 Supplier Novus Biologicals Supplier No. H00010477M04

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

UBE2E3 Monoclonal antibody specifically detects UBE2E3 in Human samples. It is validated for ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen UBE2E3
Applications ELISA, Sandwich ELISA
Classification Monoclonal
Clone 4C4
Conjugate Unconjugated
Dilution ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_006348
Gene Alias EC 6.3.2.19, UBCE4, UbcH9, UBCH9ubiquitin-conjugating enzyme E2E 3 (homologous to yeast UBC4/5), UbcM2, Ubiquitin carrier protein E3, ubiquitin-conjugating enzyme E2 E3, Ubiquitin-conjugating enzyme E2-23 kDa, ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast), Ubiquitin-protein ligase E3
Host Species Mouse
Immunogen UBE2E3 (NP_006348, 65 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDN
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 10477
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.